SolAcc

Citing

    While the manuscript has been submitted, use the URL for citation.

Start prediction

To start using SolAcc, just provide protein sequence in fasta format. For protein sequences, there are two ways to input: directly by providing FASTA sequences or uploading a fasta file. Sequences can be written or pasted to the boxes in the input forms or uploaded as a file.

The header info of each sequence must be unique.

To look for an input example, please click the "Example" text on the input page.

Input sequences

Example for input

    >example0
    GSAGEDVGAPPDHLWVHQEGIYRDEYQRTWVAVVEEETSFLRARVQQIQVPLGDAARPSHLLTSQLPLMWQLYPEERYMDNNSRLWQIQHHLMVRGVQELLLKLLPDD
    >example1
    ALTQERKREIIEQFKVHENDTGSPEVQIAILTEQINNLNEHLRVHKKDHHSRRGLLKMVGKRRRLLAYLRNKDVARYREIVEKLGLRR
                    

Data sets

Extensive data mining was performed for obtaining cases for training and testing. Blind Test data set was originally used to test SolAcc.  download

Dataset sequence residue
Training dataset 6000 1402211
Blind Test 500 118180
Validation dataset 500 121276

Mirror website

Contact

If you have any problems, please contact Mengqi Chen (20215227105@alu.suda.edu.cn).